CHST15 Rabbit Polyclonal Antibody

CAT#: TA341985

Rabbit Polyclonal Anti-GALNAC4S-6ST Antibody

Product Images

WB Suggested Anti-GALNAC4S-6ST Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: Hela cell lysate

• 

  Host: Rabbit; Target Name: CHST15; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: CHST15; Sample Tissue: Human Fetal Heart; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: CHST15; Sample Tissue: MCF7; Antibody Dilution: 1.0 ug/ml.CHST15 is supported by BioGPS gene expression data to be expressed in MCF7

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GALNAC4S-6ST antibody: synthetic peptide directed towards the middle region of human GALNAC4S-6ST. Synthetic peptide located within the following region: YDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVERLYSDYLYFASSNKS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 65 kDa
• Gene Name: carbohydrate (N-acetylgalactosamine 4-sulfate 6-O) sulfotransferase 15
• Database Link:
  NP_056976
  Entrez Gene 51363 Human
  UniProt ID Q7LFX5
• Background: Chondroitin sulfate (CS) is a glycosaminoglycan which is an important structural component ofThe extracellular matrix and which links to proteins to form proteoglycans. Chondroitin sulfate E (CS-E) is an isomer of chondroitin sulfate in whichThe C-4 and C-6 hydroxyl groups are sulfated.This gene encodes a type II transmembrane glycoprotein that acts as a sulfotransferase to transfer sulfate toThe C-6 hydroxal group of chondroitin sulfate.This gene has also been identified as being co-expressed with RAG1 in B-cells and as potentially acting as a B-cell surface signaling receptor. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2012]
• Synonyms: BRAG; GALNAC4S-6ST
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Bovine: 93%; Rabbit: 93%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Chondroitin sulfate biosynthesis