Antibodies

View as table Download

CITED2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CITED2

Rabbit Polyclonal CITED2 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CITED2 antibody was raised against an 18 amino acid synthetic peptide near the amino terminus of human CITED2.

CITED2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 207-234 amino acids from the C-terminal region of human CITED2

Rabbit polyclonal anti-CITED2 antibody (NT)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CITED2 antibody was raised against an 18 amino acid peptide near the amino terminus of human CITED2.

Rabbit Polyclonal Anti-CITED2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CITED2 antibody: synthetic peptide directed towards the N terminal of human CITED2. Synthetic peptide located within the following region: HIHYGAGNMNATSGIRHAMGPGTVNGGHPPSALAPAARFNNSQFMGPPVA

Rabbit Polyclonal Anti-CITED2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CITED2 antibody: synthetic peptide directed towards the N terminal of human CITED2. Synthetic peptide located within the following region: ADHMMAMNHGRFPDGTNGLHHHPAHRMGMGQFPSPHHHQQQQPQHAFNAL

CITED2 Antibody - middle region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse CITED2

CITED2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CITED2

CITED2 Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Modifications Unmodified