Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-CLCNKA antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human CLCNKA. |
Rabbit Polyclonal Anti-CLCNKA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLCNKA antibody: synthetic peptide directed towards the N terminal of human CLCNKA. Synthetic peptide located within the following region: MEELVGLREGFSGDPVTLQELWGPCPHIRRAIQGGLEWLKQKVFRLGEDW |
CLCNKA rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CLCNKA |
CLCNKA Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 470-644 of human CLCNKA (NP_001244068.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- CLCNKA