CLCNKA Rabbit Polyclonal Antibody

CAT#: TA338538

Rabbit Polyclonal Anti-CLCNKA Antibody

Product Images

WB Suggested Anti-CLCNKA Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CLCNKA antibody: synthetic peptide directed towards the N terminal of human CLCNKA. Synthetic peptide located within the following region: MEELVGLREGFSGDPVTLQELWGPCPHIRRAIQGGLEWLKQKVFRLGEDW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 75 kDa
• Gene Name: chloride voltage-gated channel Ka
• Database Link:
  NP_004061
  Entrez Gene 1187 Human
  UniProt ID P51800
• Background: This gene is a member of the CLC family of voltage-gated chloride channels. The encoded protein is predicted to have 12 transmembrane domains, and requires a beta subunit called barttin to form a functional channel. It is thought to function in salt reabsorption in the kidney and potassium recycling in the inner ear. The gene is highly similar to CLCNKB, which is located 10 kb downstream from this gene. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
• Synonyms: ClC-K1; CLCK1; hClC-Ka
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 90%; Pig: 85%; Rat: 85%; Mouse: 85%

Reference Data

• Protein Families: Druggable Genome, Transmembrane