Antibodies

Jump to Filters
View as table Download
CLDN16 Rabbit Polyclonal Antibody
TA371650

USD 380.00

4 Weeks

CLDN16 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CLDN16
CLDN16 (N-term) Rabbit Polyclonal Antibody
AP50943PU-N

USD 450.00

2 Weeks

CLDN16 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 13-41 amino acids from the N-terminal region of human CLDN16
CLDN16 Rabbit Polyclonal Antibody
TA334204

USD 375.00

5 Days

Rabbit Polyclonal Anti-CLDN16 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN16 antibody: synthetic peptide directed towards the C terminal of human CLDN16. Synthetic peptide located within the following region: FLAGAVLTCCLYLFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTETA
CLDN16 Rabbit Polyclonal Antibody
TA334205

USD 310.00

5 Days

Rabbit Polyclonal Anti-CLDN16 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN16 antibody: synthetic peptide directed towards the C terminal of human CLDN16. Synthetic peptide located within the following region: FLAGAVLTCCLYLFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTETA
CLDN16 Rabbit Polyclonal Antibody
TA367417

USD 380.00

4 Weeks

CLDN16 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CLDN16
CLDN16 Rabbit Polyclonal Antibody
TA374846

USD 220.00

3 Weeks

CLDN16 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human CLDN16 (NP_006571.1).
Modifications Unmodified