Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-Claudin 4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Claudin 4 Antibody: A synthesized peptide derived from human Claudin 4 |
Antibodies
View as table Download
Claudin 4 (CLDN4) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 177~206 amino acids from the C-terminal region of human CLDN4 |
Rabbit Polyclonal Anti-CLDN4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLDN4 antibody is: synthetic peptide directed towards the C-terminal region of Human CLDN4. Synthetic peptide located within the following region: KREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAAS |
Rabbit anti Claudin 4 Polyclonal Antibody
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Anti-CLDN4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 193-209 amino acids of Human claudin 4 |
CLDN4 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human CLDN4 (NP_001296.1). |
| Modifications | Unmodified |
CLDN4 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human CLDN4 |
| Modifications | Unmodified |
Active filters
Target Symbol
- CLDN4