Germany
Japan
United Kingdom
China
Antibodies
View as table Download
CLDND1 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 50~80 amino acids from the Central region of human CLDND |
Rabbit Polyclonal Anti-CLDND1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CLDND1 Antibody: synthetic peptide directed towards the middle region of human CLDND1. Synthetic peptide located within the following region: TLTEQFMEKFVDPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGL |
CLDND1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CLDND1 |
CLDND1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CLDND1 |
CLDND1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CLDND1 |
| Modifications | Unmodified |
Active filters
Target Symbol
- CLDND1