Rabbit Polyclonal Anti-CLIC6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLIC6 antibody: synthetic peptide directed towards the middle region of human CLIC6. Synthetic peptide located within the following region: RREDGEASEPRALGQEHDITLFVKAGYDGESIGNCPFSQRLFMILWLKGV |
Rabbit polyclonal anti-CLIC6 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CLIC6. |
CLIC6 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CLIC6 |
Germany
Japan
United Kingdom
China
