CLIC6 Rabbit Polyclonal Antibody

CAT#: TA338724

Rabbit Polyclonal Anti-CLIC6 Antibody

Product Images

WB Suggested Anti-CLIC6 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:2500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CLIC6 antibody: synthetic peptide directed towards the middle region of human CLIC6. Synthetic peptide located within the following region: RREDGEASEPRALGQEHDITLFVKAGYDGESIGNCPFSQRLFMILWLKGV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 75 kDa
• Gene Name: chloride intracellular channel 6
• Database Link:
  NP_444507
  Entrez Gene 54102 Human
  UniProt ID Q96NY7
• Background: This gene encodes a member of the chloride intracellular channel family of proteins. The gene is part of a large triplicated region found on chromosomes 1, 6, and 21. An alternatively spliced transcript variant has been described, but its biological validity has not been determined. [provided by RefSeq, Jul 2008]
• Synonyms: CLIC1L
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%

Reference Data

• Protein Families: Druggable Genome