Antibodies

Jump to Filters
View as table Download
ASAM (CLMP) (Center) Rabbit Polyclonal Antibody
AP50265PU-N

USD 450.00

2 Weeks

ASAM (CLMP) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 80-111 amino acids from the Central region of human ASAM
Clmp Rabbit Polyclonal Antibody
TA338676

USD 375.00

5 Days

Rabbit Polyclonal Anti-Clmp Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Clmp antibody is: synthetic peptide directed towards the N-terminal region of Rat Clmp. Synthetic peptide located within the following region: LWLVTYYVGTLGTHTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDN