Clmp Rabbit Polyclonal Antibody

CAT#: TA338676

Rabbit Polyclonal Anti-Clmp Antibody

Product Images

Host: Rabbit; Target Name: Clmp; Sample Tissue: Rat Stomach lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Clmp antibody is: synthetic peptide directed towards the N-terminal region of Rat Clmp. Synthetic peptide located within the following region: LWLVTYYVGTLGTHTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: CXADR-like membrane protein
• Database Link:
  NP_775177
  Entrez Gene 286939 Rat
  UniProt ID Q8K1G0
• Background: Human homolog plays a role in cell-cell adhesion.
• Synonyms: ACAM; ASAM; CSBM
• Note: Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Guinea pig: 93%