Antibodies

Jump to Filters
View as table Download
CLSTN3 Rabbit Polyclonal Antibody
TA341951

USD 375.00

5 Days

Rabbit Polyclonal Anti-CLSTN3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLSTN3 antibody: synthetic peptide directed towards the N terminal of human CLSTN3. Synthetic peptide located within the following region: QICYYEILTPNTPFLIDNDGNIENTEKLQYSGERLYKFTVTAYDCGKKRA
CLSTN3 Rabbit Polyclonal Antibody
TA374897

USD 220.00

3 Weeks

CLSTN3 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 730-850 of human CLSTN3 (NP_055533.2).
Modifications Unmodified