CLSTN3 Rabbit Polyclonal Antibody

CAT#: TA341951

Rabbit Polyclonal Anti-CLSTN3 Antibody

Product Images

WB Suggested Anti-CLSTN3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: RPMI 8226 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CLSTN3 antibody: synthetic peptide directed towards the N terminal of human CLSTN3. Synthetic peptide located within the following region: QICYYEILTPNTPFLIDNDGNIENTEKLQYSGERLYKFTVTAYDCGKKRA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 106 kDa
• Gene Name: calsyntenin 3
• Database Link:
  NP_055533
  Entrez Gene 9746 Human
  UniProt ID Q9BQT9
• Background: May modulate calcium-mediated postsynaptic signals (By similarity). Complex formation with APBA2 and APP, stabilizes APP metabolism and enhances APBA2-mediated suppression of beta-APP40 secretion, due toThe retardation of intracellular APP maturation.
• Synonyms: alcbeta; CDHR14; CSTN3
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transmembrane