Antibodies

Jump to Filters
View as table Download
C16orf61 (CMC2) Rabbit Polyclonal Antibody
TA590854

USD 409.00

In Stock

Rabbit Polyclonal CMC2 Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the entire range of the target protein.
C16orf61 (CMC2) Rabbit Polyclonal Antibody
TA344804

USD 475.00

5 Days

Rabbit Polyclonal Anti-C16orf61 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C16orf61 antibody: synthetic peptide directed towards the middle region of human C16orf61. Synthetic peptide located within the following region: NILKFFGYCNDVDRELRKCLKNEYVENRTKSREHGIAMRKKLFNPPEESE