C16orf61 (CMC2) Rabbit Polyclonal Antibody

CAT#: TA344804

Rabbit Polyclonal Anti-C16orf61 Antibody - middle region

Product Images

WB Suggested Anti-C16orf61 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human kidney

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C16orf61 antibody: synthetic peptide directed towards the middle region of human C16orf61. Synthetic peptide located within the following region: NILKFFGYCNDVDRELRKCLKNEYVENRTKSREHGIAMRKKLFNPPEESE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 9 kDa
• Gene Name: C-x9-C motif containing 2
• Database Link:
  NP_064573
  Entrez Gene 56942 Human
  UniProt ID Q9NRP2
• Background: The function of this protein remains unknown.
• Synonyms: 2310061C15Rik; C16orf61; DC13
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 79%; Horse: 79%; Mouse: 79%; Guinea pig: 79%; Rat: 77%; Bovine: 77%