Rabbit Polyclonal Anti-COG6 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-COG6 antibody is: synthetic peptide directed towards the C-terminal region of Human COG6. Synthetic peptide located within the following region: ADMATFMVNSLYMMKTTLALFEFTDRRLEMLQFQIEAHLDTLINEQASYV |
COG6 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 508-657 of human COG6 (NP_065802.1). |
| Modifications | Unmodified |
COG6 Rabbit monoclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
