Antibodies

Jump to Filters
View as table Download
COL27A1 Rabbit Polyclonal Antibody
TA342817

USD 375.00

5 Days

Rabbit Polyclonal Anti-COL27A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-COL27A1 antibody is: synthetic peptide directed towards the middle region of Human COL27A1. Synthetic peptide located within the following region: LPGPKGDKGSRGDWGLQGPRGPPGPRGRPGPPGPPGGPIQLQQDDLGAAF