COL27A1 Rabbit Polyclonal Antibody

CAT#: TA342817

Rabbit Polyclonal Anti-COL27A1 Antibody

Product Images

Host: Rabbit; Target Name: COL27A1; Sample Tissue: Fetal Lung lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-COL27A1 antibody is: synthetic peptide directed towards the middle region of Human COL27A1. Synthetic peptide located within the following region: LPGPKGDKGSRGDWGLQGPRGPPGPRGRPGPPGPPGGPIQLQQDDLGAAF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 90 kDa
• Gene Name: collagen type XXVII alpha 1
• Database Link:
  NP_116277
  Entrez Gene 85301 Human
  UniProt ID Q8IZC6
• Background: Fibrillar collagens, such as COL27A1, compose one of the most ancient families of extracellular matrix molecules. They form major structural elements in extracellular matrices of cartilage, skin, and tendon.
• Synonyms: STLS
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 86%; Horse: 86%; Bovine: 86%; Rabbit: 86%; Rat: 85%; Mouse: 85%; Sheep: 85%; Zebrafish: 85%