Germany
Japan
United Kingdom
China
COX7A2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | COX7A2 antibody was raised against synthetic peptide from human COX7S/A2 (aa1-50). |
Antibodies
View as table Download
Rabbit Polyclonal Anti-COX7A2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-COX7A2 antibody is: synthetic peptide directed towards the middle region of Human COX7A2. Synthetic peptide located within the following region: ASRRHFKNKVPEKQKLFQEDDEIPLYLKGGVADALLYRATMILTVGGTAY |
Rabbit Polyclonal Anti-COX7A2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-COX7A2 antibody is: synthetic peptide directed towards the C-terminal region of Human COX7A2. Synthetic peptide located within the following region: LFQEDDEIPLYLKGGVADALLYRATMILTVGGTAYAIYELAVASFPKKQE |
COX7A2 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human COX7A2 |
COX7A2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 33-115 of human COX7A2 (NP_001856.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- COX7A2