COX7A2 Rabbit Polyclonal Antibody

CAT#: TA331318

Rabbit Polyclonal Anti-COX7A2 Antibody

Product Images

Host: Rabbit; Target Name: COX7A2; Sample Tissue: MCF7 Whole Cell lysates; Antibody Dilution: 1.0ug/ml; COX7A2 is supported by BioGPS gene expression data to be expressed in MCF7

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-COX7A2 antibody is: synthetic peptide directed towards the middle region of Human COX7A2. Synthetic peptide located within the following region: ASRRHFKNKVPEKQKLFQEDDEIPLYLKGGVADALLYRATMILTVGGTAY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 12 kDa
• Gene Name: cytochrome c oxidase subunit 7A2
• Database Link:
  NP_001856
  Entrez Gene 1347 Human
  UniProt ID P14406
• Background: Cytochrome c oxidase, the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of three catalytic subunits encoded by mitochondrial genes, and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, while the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes polypeptide 2 (liver isoform) of subunit VIIa, with this polypeptide being present in both muscle and non-muscle tissues. In addition to polypeptide 2, subunit VIIa includes polypeptide 1 (muscle isoform), which is present only in muscle tissues, and a related protein, which is present in all tissues.
• Synonyms: COX7AL; COX7AL1; COXVIIa-L; COXVIIAL; VIIAL
• Note: Human: 100%; Dog: 85%; Pig: 85%; Horse: 85%; Sheep: 85%; Bovine: 85%; Rabbit: 85%; Guinea pig: 85%; Rat: 77%; Mouse: 77%; Zebrafish: 75%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Oxidative phosphorylation, Parkinson's disease