Antibodies

Jump to Filters
View as table Download
CPSF6 Rabbit Polyclonal Antibody
TA345993

USD 410.00

5 Days

Rabbit Polyclonal Anti-CPSF6 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CPSF6 antibody: synthetic peptide directed towards the middle region of human CPSF6. Synthetic peptide located within the following region: PPLAGPPNRGDRPPPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPP
CPSF6 Rabbit Polyclonal Antibody
TA375053

USD 220.00

3 Weeks

CPSF6 Rabbit polyclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CPSF6
Modifications Unmodified