Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Cr1l mouse monoclonal antibody, clone 512, Aff - Purified
| Applications | FC, IHC |
| Reactivities | Rat |
Cr1l mouse monoclonal antibody, clone 512, Biotin
| Applications | FC, IHC |
| Reactivities | Rat |
| Conjugation | Biotin |
Cr1l mouse monoclonal antibody, clone 512, FITC
| Applications | FC, IHC |
| Reactivities | Rat |
| Conjugation | FITC |
Cr1l mouse monoclonal antibody, clone 512, Purified
| Applications | FC, IHC |
| Reactivities | Rat |
Rabbit Polyclonal Anti-CR1L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CR1L antibody is: synthetic peptide directed towards the middle region of Human CR1L. Synthetic peptide located within the following region: ALNKWEPELPSCSRVCQPPPDVLHAERTQRDKDNFSPGQEVFYSCEPGYD |
Rabbit Polyclonal Anti-CR1L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CR1L antibody is: synthetic peptide directed towards the N-terminal region of Human CR1L. Synthetic peptide located within the following region: IGTYLNYECRPGYSGRPFSIICLKNSVWTSAKDKCKRKSCRNPPDPVNGM |
CR1L rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CR1L |
Active filters
Target Symbol
- CR1L