Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Polyclonal Antibody against CRKL
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KIFDPQNPDENE, from the C Terminus of the protein sequence according to NP_005198. |
Rabbit monoclonal antibody against Phospho CrkL (pY207)(EP270Y) (phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Modifications | Phospho-specific |
CRKL pTyr207 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
CRKL rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
Rabbit Polyclonal anti-CRKL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CRKL antibody is: synthetic peptide directed towards the middle region of Human CRKL. Synthetic peptide located within the following region: RSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPS |
CRKL Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human CRKL |
| Modifications | Unmodified |
CRKL Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-303 of human CRKL (NP_005198.1). |
| Modifications | Unmodified |
Phospho-CRKL-Y207 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic phosphorylated peptide around Y207 of human CRKL (NP_005198.1). |
| Modifications | Phospho Y207 |
CrkL (phospho-Y207) polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phosphopeptide derived from human CrkL around the phosphorylation site of Tyrosine 207. |
Active filters
Target Symbol
- CRKL
Filter by
Category
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Families
Pathways
- Chemokine signaling pathway (7)
- Chronic myeloid leukemia (7)
- ErbB signaling pathway (7)
- Fc gamma R-mediated phagocytosis (7)
- Focal adhesion (7)
- Insulin signaling pathway (7)
- MAPK signaling pathway (7)
- Neurotrophin signaling pathway (7)
- Pathways in cancer (7)
- Regulation of actin cytoskeleton (7)
- Renal cell carcinoma (7)