Germany
Japan
United Kingdom
China
Goat Polyclonal Antibody against CRP2 / CSRP2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-ERLGIKPESVQP, from the internal region of the protein sequence according to NP_001312.1. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-CSRP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CSRP2 antibody: synthetic peptide directed towards the C terminal of human CSRP2. Synthetic peptide located within the following region: FRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ |
Rabbit Polyclonal Anti-Csrp2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Csrp2 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IKPESAQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAAEKIIGAGKPW |
CSRP2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CSRP2 |
CSRP2 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CSRP2 |
CSRP2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-193 of human CSRP2 (NP_001312.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- CSRP2