CSRP2 Rabbit Polyclonal Antibody

CAT#: TA335869

Rabbit Polyclonal Anti-Csrp2 Antibody

Product Images

WB Suggested Anti-Csrp2 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Pancreas

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Csrp2 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IKPESAQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAAEKIIGAGKPW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 21 kDa
• Gene Name: cysteine and glycine rich protein 2
• Database Link:
  NP_001312
  Entrez Gene 13008 Mouse
  UniProt ID Q16527
• Background: Csrp2 is drastically down-regulated in response to PDGF-BB or cell injury, that promote smooth muscle cell proliferation and dedifferentiation. It seems to play a role in the development of the embryonic vascular system.
• Synonyms: CRP2; LMO5; SmLIM
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%; Dog: 86%