Antibodies

View as table Download

Rabbit Polyclonal Anti-Cyb5r2 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Cyb5r2 Antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: WEYSSGFITADMIKEHLPPPGEATLILVCGPPPLIQEAAHPSLEQLGYTK

Carrier-free (BSA/glycerol-free) CYB5R2 mouse monoclonal antibody, clone OTI4B9 (formerly 4B9)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

CYB5R2 mouse monoclonal antibody, clone OTI4B9 (formerly 4B9)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

CYB5R2 mouse monoclonal antibody, clone OTI4B9 (formerly 4B9)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated