Rabbit Polyclonal Anti-XTP3TPA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-XTP3TPA antibody: synthetic peptide directed towards the N terminal of human XTP3TPA. Synthetic peptide located within the following region: MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQF |
Rabbit Polyclonal Anti-XTP3TPA Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-XTP3TPA antibody: synthetic peptide directed towards the middle region of human XTP3TPA. Synthetic peptide located within the following region: KMDINRRRYPAHLARSSSRKYTELPHGAISEDQAVGPADIPCDSTGQTST |
DCTPP1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DCTPP1 |
Germany
Japan
United Kingdom
China
