XTP3TPA (DCTPP1) Rabbit Polyclonal Antibody

CAT#: TA339362

Rabbit Polyclonal Anti-XTP3TPA Antibody

Product Images

WB Suggested Anti-XTP3TPA Antibody Titration: 0.5 ug/ml; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-XTP3TPA antibody: synthetic peptide directed towards the N terminal of human XTP3TPA. Synthetic peptide located within the following region: MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 19 kDa
• Gene Name: dCTP pyrophosphatase 1
• Database Link:
  NP_077001
  Entrez Gene 79077 Human
  UniProt ID Q9H773
• Background: Hydrolyzes deoxynucleoside triphosphates (dNTPs) to the corresponding nucleoside monophosphates. Has a strong preference for modified dCTP. Activity is highest with 5-iodo-dCTP, followed by 5-bromo-dCTP, unmodified dCTP, 5-methyl-dCTP and 5-chloro-dCTP. Hydrolyzes 2-chloro-dATP and 2-hydroxy-dATP with lower efficiency, and has even lower activity with unmodified dATP, dTTP and dUTP (in vitro). Does not hydrolyze ATP, UTP, ITP, GTP, dADP, dCDP or dGTP. May protect DNA or RNA against the incorporation of non-canonical nucleotide triphosphates. May protect cells against inappropriate methylation of CpG islands by DNA methyltransferases.
• Synonyms: CDA03; RS21C6; XTP3TPA
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Stem cell - Pluripotency