Rabbit Polyclonal Anti-DDX50 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDX50 antibody: synthetic peptide directed towards the N terminal of human DDX50. Synthetic peptide located within the following region: PGKLLWGDIMELEAPLEESESQKKERQKSDRRKSRHHYDSDEKSETRENG |
Rabbit Polyclonal Anti-DDX50 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDX50 antibody: synthetic peptide directed towards the N terminal of human DDX50. Synthetic peptide located within the following region: EESESQKKERQKSDRRKSRHHYDSDEKSETRENGVTDDLDAPKAKKSKMK |
DDX50 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DDX50 |
DDX50 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-135 of human DDX50 (NP_076950.1). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
