DDX50 Rabbit Polyclonal Antibody

CAT#: TA341620

Rabbit Polyclonal Anti-DDX50 Antibody

Product Images

WB Suggested Anti-DDX50 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: 293T cell lysateDDX50 is supported by BioGPS gene expression data to be expressed in HEK293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DDX50 antibody: synthetic peptide directed towards the N terminal of human DDX50. Synthetic peptide located within the following region: PGKLLWGDIMELEAPLEESESQKKERQKSDRRKSRHHYDSDEKSETRENG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 82 kDa
• Gene Name: DEAD-box helicase 50
• Database Link:
  NP_076950
  Entrez Gene 79009 Human
  UniProt ID Q9BQ39
• Background: DEAD box proteins, characterized byThe conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases.They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based onTheir distribution patterns, some members ofThis DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.This gene encodes a DEAD box enzyme that may be involved in ribosomal RNA synthesis or processing.This gene and DDX21, also called RH-II/GuA, have similar genomic structures and are in tandem orientation on chromosome 10, suggesting thatThe two genes arose by gene duplication in evolution.This gene has pseudogenes on chromosomes 2, 3 and 4. Alternative splicing ofThis gene generates multiple transcript variants, butThe full length nature of allThe other variants but one has not been defined. [provided by RefSeq, Jul 2008]
• Synonyms: GU2; GUB; GuB; mcdrh; RH-II
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 93%; Rat: 92%; Pig: 86%; Horse: 86%; Bovine: 86%; Guinea pig: 77%