Rabbit Polyclonal Anti-DGCR8 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DGCR8 antibody: synthetic peptide directed towards the N terminal of human DGCR8. Synthetic peptide located within the following region: DKKDEENELDQEKRVEYAVLDELEDFTDNLELDEEGAGGFTAKAIVQRDR |
Rabbit anti-DGCR8 polyclonal antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide conjugated to KLH |
DGCR8 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human DGCR8 |
DGCR8 Rabbit polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human DGCR8. |
DGCR8 Rabbit polyclonal Antibody
| Applications | IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human DGCR8 |
Germany
Japan
United Kingdom
China
