RNA Helicase A (DHX9) mouse monoclonal antibody, clone 3G7, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
RNA Helicase A (DHX9) mouse monoclonal antibody, clone 3G7, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Rabbit polyclonal DHX9 Antibody (N-term)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This DHX9 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human DHX9. |
Goat Anti-DHX9 / RHA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence TEGRNALIHKSSVNC, from the internal region of the protein sequence according to NP_001348.2. |
Rabbit Polyclonal Anti-DHX9 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DHX9 antibody: synthetic peptide directed towards the N terminal of human DHX9. Synthetic peptide located within the following region: GLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIK |
DHX9 Antibody - middle region
Applications | WB |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse DHX9 |
DHX9/RNA Helicase A Rabbit polyclonal Antibody
Applications | IF, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human DHX9/RNA Helicase A |
Modifications | Unmodified |
RNA Helicase A Rabbit polyclonal Antibody
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human RNA Helicase A |
RNA Helicase A Rabbit monoclonal Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |