Antibodies

View as table Download

Rabbit polyclonal DHX9 Antibody (N-term)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This DHX9 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human DHX9.

Goat Anti-DHX9 / RHA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence TEGRNALIHKSSVNC, from the internal region of the protein sequence according to NP_001348.2.

Rabbit Polyclonal Anti-DHX9 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DHX9 antibody: synthetic peptide directed towards the N terminal of human DHX9. Synthetic peptide located within the following region: GLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIK

DHX9 Antibody - middle region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse DHX9

DHX9/RNA Helicase A Rabbit polyclonal Antibody

Applications IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human DHX9/RNA Helicase A
Modifications Unmodified

RNA Helicase A Rabbit polyclonal Antibody

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human RNA Helicase A