RNA Helicase A (DHX9) Rabbit Polyclonal Antibody

CAT#: TA341556

Rabbit Polyclonal Anti-DHX9 Antibody

Product Images

WB Suggested Anti-DHX9 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Transfected 293T

• 

  Human Pancreas

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DHX9 antibody: synthetic peptide directed towards the N terminal of human DHX9. Synthetic peptide located within the following region: GLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 141 kDa
• Gene Name: DEAH-box helicase 9
• Database Link:
  NP_001348
  Entrez Gene 1660 Human
  UniProt ID Q08211
• Background: This gene encodes a member ofThe DEAH-containing family of RNA helicases.The encoded protein is an enzyme that catalyzesThe ATP-dependent unwinding of double-stranded RNA and DNA-RNA complexes.This protein localizes to bothThe nucleus andThe cytoplasm and functions as a transcriptional regulator.This protein may also be involved inThe expression and nuclear export of retroviral RNAs. Alternate splicing results in multiple transcript variants. Pseudogenes ofThis gene are found on chromosomes 11 and 13. [provided by RefSeq, Feb 2010]
• Synonyms: DDX9; LKP; NDH2; NDHII; RHA
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%