DLX2 mouse monoclonal antibody, clone 2B12, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse |
DLX2 mouse monoclonal antibody, clone 2B12, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse |
DLX2 mouse monoclonal antibody, clone 2C8, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse |
DLX2 mouse monoclonal antibody, clone 2E12, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse |
Rabbit Polyclonal anti-DLX2 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DLX2 antibody: synthetic peptide directed towards the N terminal of human DLX2. Synthetic peptide located within the following region: MTGVFDSLVADMHSTQIAASSTYHQHQQPPSGGGAGPGGNSSSSSSLHKP |
Rabbit Polyclonal Anti-DLX2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DLX2 antibody: synthetic peptide directed towards the C terminal of human DLX2. Synthetic peptide located within the following region: PASWDFGVPQRMAGGGGPGSGGSGAGSSGSSPSSAASAFLGNYPWYHQTS |
DLX2 (Center) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human DLX2 |
DLX2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human DLX2 (NP_004396.1). |
Modifications | Unmodified |