DLX2 Rabbit Polyclonal Antibody
Other products for "DLX2"
Specifications
Product Data | |
Applications | IHC, WB |
Recommended Dilution | WB, IHC |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-DLX2 antibody: synthetic peptide directed towards the C terminal of human DLX2. Synthetic peptide located within the following region: PASWDFGVPQRMAGGGGPGSGGSGAGSSGSSPSSAASAFLGNYPWYHQTS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 27 kDa |
Gene Name | distal-less homeobox 2 |
Database Link | |
Background | Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less (Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. The DLX proteins are postulated to play a role in forebrain and craniofacial development. |
Synonyms | TES-1; TES1 |
Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100% |
Reference Data | |
Protein Families | ES Cell Differentiation/IPS, Stem cell relevant signaling - TGFb/BMP signaling pathway, Transcription Factors |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.