Antibodies

Jump to Filters
View as table Download
Dermokine (DMKN) Rabbit Polyclonal Antibody
TA331201

USD 375.00

5 Days

Rabbit Polyclonal Anti-DMKN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-DMKN antibody is: synthetic peptide directed towards the C-terminal region of Human DMKN. Synthetic peptide located within the following region: QPGAGWQEVAAVTSKNYNYNQHAYPTAYGGKYSVKTPAKGGVSPSSSASR
Dermokine (DMKN) Rabbit Polyclonal Antibody
TA375510

USD 220.00

3 Weeks

DMKN Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 355-449 of human DMKN (NP_001177276.1).
Modifications Unmodified