Dermokine (DMKN) Rabbit Polyclonal Antibody

CAT#: TA331201

Rabbit Polyclonal Anti-DMKN Antibody

Product Images

WB Suggested Anti-DMKN Antibody; Titration: 1.0 ug/ml; Positive Control: Jurkat Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-DMKN antibody is: synthetic peptide directed towards the C-terminal region of Human DMKN. Synthetic peptide located within the following region: QPGAGWQEVAAVTSKNYNYNQHAYPTAYGGKYSVKTPAKGGVSPSSSASR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 43 kDa
• Gene Name: dermokine
• Database Link:
  NP_001177276
  Entrez Gene 93099 Human
  UniProt ID Q6E0U4
• Background: This gene is upregulated in inflammatory diseases, and it was first observed as expressed in the differentiated layers of skin. The most interesting aspect of this gene is the differential use of promoters and terminators to generate isoforms with unique cellular distributions and domain components. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene.
• Synonyms: UNQ729; ZD52F10
• Note: Human: 100%; Dog: 86%; Bovine: 86%; Rabbit: 86%