Rabbit Polyclonal Anti-DPY19L3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DPY19L3 Antibody is: synthetic peptide directed towards the N-terminal region of Human DPY19L3. Synthetic peptide located within the following region: QMLQAPTLVQGFHGLIYDNKTESMKTINLLQRMNIYQEVFLSILYRVLPI |
Rabbit Polyclonal Anti-DPY19L3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DPY19L3 Antibody is: synthetic peptide directed towards the C-terminal region of Human DPY19L3. Synthetic peptide located within the following region: TNHPHYEDSSLRERTRAVYQIYAKRAPEEVHALLRSFGTDYVILEDSICY |
DPY19L3 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DPY19L3 |
Germany
Japan
United Kingdom
China
