DPY19L3 Rabbit Polyclonal Antibody

CAT#: TA331497

Rabbit Polyclonal Anti-DPY19L3 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "DPY19L3"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-DPY19L3 Antibody is: synthetic peptide directed towards the N-terminal region of Human DPY19L3. Synthetic peptide located within the following region: QMLQAPTLVQGFHGLIYDNKTESMKTINLLQRMNIYQEVFLSILYRVLPI
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 83 kDa
Gene Name dpy-19 like 3 (C. elegans)
Background The function of this protein remains unknown.
Synonyms DKFZp686J17135; MGC35440
Note Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 100%; Dog: 93%; Mouse: 93%; Rabbit: 93%; Bovine: 92%; Horse: 86%
Reference Data
Protein Families Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.