Antibodies

Jump to Filters
View as table Download
DUS1L Rabbit Polyclonal Antibody
TA344690

USD 475.00

5 Days

Rabbit Polyclonal Anti-DUS1L Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DUS1L antibody: synthetic peptide directed towards the middle region of human DUS1L. Synthetic peptide located within the following region: EEEEGGTEVLSKNKQKKQLRNPHKTFDPSLKPKYAKCDQCGNPKGNRCVF
DUS1L Rabbit Polyclonal Antibody
TA344691

USD 475.00

5 Days

Rabbit Polyclonal Anti-DUS1L Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DUS1L antibody: synthetic peptide directed towards the middle region of human DUS1L. Synthetic peptide located within the following region: KPTGDLPFHWICQPYIRPGPREGSKEKAGARSKRALEEEEGGTEVLSKNK
DUS1L (C-term) Rabbit Polyclonal Antibody
AP51337PU-N

USD 450.00

2 Weeks

DUS1L (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 320-349 amino acids from the C-terminal region of human DUS1L.
DUS1L Rabbit Polyclonal Antibody
TA362473

USD 360.00

5 Days

DUS1L Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human DUS1L