DUS1L Rabbit Polyclonal Antibody

CAT#: TA344691

Rabbit Polyclonal Anti-DUS1L Antibody - middle region

Product Images

WB Suggested Anti-DUS1L Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DUS1L antibody: synthetic peptide directed towards the middle region of human DUS1L. Synthetic peptide located within the following region: KPTGDLPFHWICQPYIRPGPREGSKEKAGARSKRALEEEEGGTEVLSKNK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 53 kDa
• Gene Name: dihydrouridine synthase 1 like
• Database Link:
  NP_071439
  Entrez Gene 64118 Human
  UniProt ID Q6P1R4
• Background: DUS1L catalyzes the synthesis of dihydrouridine, a modified base found in the D-loop of most tRNAs.
• Synonyms: DUS1; PP3111
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Pig: 92%; Guinea pig: 92%; Bovine: 86%