Rabbit Polyclonal Anti-DYNLRB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DYNLRB1 antibody is: synthetic peptide directed towards the N-terminal region of Human DYNLRB1. Synthetic peptide located within the following region: VNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIR |
Rabbit Polyclonal Anti-DYNLRB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DYNLRB1 antibody is: synthetic peptide directed towards the N-terminal region of Human DYNLRB1. Synthetic peptide located within the following region: EVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILK |
DYNLRB1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DYNLRB1 |
DYNLRB1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-63 of human DYNLRB1 (NP_001268656.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
