DYNLRB1 Rabbit Polyclonal Antibody

CAT#: TA338095

Rabbit Polyclonal Anti-DYNLRB1 Antibody

Product Images

WB Suggested Anti-DYNLRB1 Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DYNLRB1 antibody is: synthetic peptide directed towards the N-terminal region of Human DYNLRB1. Synthetic peptide located within the following region: EVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 11 kDa
• Gene Name: dynein light chain roadblock-type 1
• Database Link:
  NP_054902
  Entrez Gene 83658 Human
  UniProt ID Q9NP97
• Background: This gene is a member of the roadblock dynein light chain family and encodes a cytoplasmic protein that is capable of binding intermediate chain proteins. Upregulation of this gene has been associated with hepatocellular carcinomas, suggesting that this gene may be involved in tumor progression.
• Synonyms: BITH; BLP; DNCL2A; DNLC2A; ROBLD1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%