Germany
Japan
United Kingdom
China
Goat Polyclonal Antibody against DBNL
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence AANLSRNGPALQE-C, from the N Terminus of the protein sequence according to NP_054782.2; NP_001014436.1. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-DBNL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DBNL antibody: synthetic peptide directed towards the middle region of human DBNL. Synthetic peptide located within the following region: QESAVHPREIFKQKERAMSTTSISSPQPGKLRSPFLQKQLTQPETHFGRE |
DBNL Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 131-430 of human DBNL (NP_001014436.1). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
DBNL mouse monoclonal antibody, clone OTI7B7 (formerly 7B7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
DBNL mouse monoclonal antibody, clone OTI7B7 (formerly 7B7), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
DBNL mouse monoclonal antibody, clone OTI7B7 (formerly 7B7), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
DBNL mouse monoclonal antibody, clone OTI7B7 (formerly 7B7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- DBNL