Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-DDB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDB2 antibody: synthetic peptide directed towards the C terminal of human DDB2. Synthetic peptide located within the following region: IVVGRYPDPNFKSCTPYELRTIDVFDGNSGKMMCQLYDPESSGISSLNEF |
Carrier-free (BSA/glycerol-free) DDB2 mouse monoclonal antibody,clone OTI2E12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
DDB2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human DDB2 |
DDB2 rabbit polyclonal antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DDB2 |
DDB2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DDB2 |
DDB2 mouse monoclonal antibody,clone OTI2E12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
DDB2 mouse monoclonal antibody,clone OTI2E12, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
DDB2 mouse monoclonal antibody,clone OTI2E12, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
DDB2 mouse monoclonal antibody,clone OTI2E12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- DDB2