Rabbit Polyclonal Anti-DDO Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDO antibody: synthetic peptide directed towards the N terminal of human DDO. Synthetic peptide located within the following region: TQKQWFRETFNHLFAIANSAEAGDAGVHLVSGWQIFQSTPTEEVPFWADV |
Rabbit Polyclonal Anti-DDO Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDO antibody: synthetic peptide directed towards the C terminal of human DDO. Synthetic peptide located within the following region: RDGSGLTYIYPGTSHVTLGGTRQKGDWNLSPDAENSREILSRCCALEPSL |
DDO Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-369 of human DDO (NP_003640.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China