Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-DDX24 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DDX24. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-DDX24 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDX24 antibody: synthetic peptide directed towards the middle region of human DDX24. Synthetic peptide located within the following region: ELRHLLSQPLFTESQKTKYPTQSGKPPLLVSAPSKSESALSCLSKQKKKK |
DDX24 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DDX24 |
DDX24 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DDX24 |
DDX24 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 510-859 of human DDX24 (NP_065147.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- DDX24