DDX24 Rabbit Polyclonal Antibody

CAT#: TA341611

Rabbit Polyclonal Anti-DDX24 Antibody

Product Images

WB Suggested Anti-DDX24 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: OVCAR-3 cell lysateDDX24 is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DDX24 antibody: synthetic peptide directed towards the middle region of human DDX24. Synthetic peptide located within the following region: ELRHLLSQPLFTESQKTKYPTQSGKPPLLVSAPSKSESALSCLSKQKKKK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 96 kDa
• Gene Name: DEAD-box helicase 24
• Database Link:
  NP_065147
  Entrez Gene 57062 Human
  UniProt ID Q9GZR7
• Background: DEAD box proteins, characterized byThe conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases.They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based onTheir distribution patterns, some members ofThis family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.This gene encodes a DEAD box protein, which shows little similarity to any ofThe other known human DEAD box proteins, but shows a high similarity to mouse Ddx24 atThe amino acid level. [provided by RefSeq, Jul 2008]
• Synonyms: DEAD; DEAD (Asp-Glu-Ala-Asp) box polypeptide 24; H (Asp-Glu-Ala-Asp; His) box polypeptide 24; S. cerevisiae CHL1-like helicase
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 79%; Mouse: 79%