Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-DDX54 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DDX54. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-Ddx54 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Ddx54 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ISSSYKRDLYQKWKQKQKIDDRDSEEEGPSNQRGPGPRRGGKRGRSQGTS |
Rabbit Polyclonal Anti-DDX54 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDX54 antibody: synthetic peptide directed towards the C terminal of human DDX54. Synthetic peptide located within the following region: GPNRGAKRRREEARQRDQEFYIPYRPKDFDSERGLSISGEGGAFEQQAAG |
DDX54 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DDX54 |
Active filters
Target Symbol
- DDX54