DDX54 Rabbit Polyclonal Antibody

CAT#: TA341622

Rabbit Polyclonal Anti-DDX54 Antibody

Product Images

WB Suggested Anti-DDX54 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DDX54 antibody: synthetic peptide directed towards the C terminal of human DDX54. Synthetic peptide located within the following region: GPNRGAKRRREEARQRDQEFYIPYRPKDFDSERGLSISGEGGAFEQQAAG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 97 kDa
• Gene Name: DEAD-box helicase 54
• Database Link:
  NP_076977
  Entrez Gene 79039 Human
  UniProt ID Q8TDD1
• Background: This gene encodes a member ofThe DEAD box protein family. DEAD box proteins, characterized byThe conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases.They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based onTheir distribution patterns, some members ofThis family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.The nucleolar protein encoded byThis gene interacts in a hormone-dependent manner with nuclear receptors, and repressesTheir transcriptional activity. Alternative splice variants that encode different isoforms have been found forThis gene. [provided by RefSeq, Jul 2008]
• Synonyms: DP97
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Bovine: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Rabbit: 92%; Zebrafish: 92%; Pig: 85%; Guinea pig: 85%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors